We build your custom website

We create your new online store or landing page. Choose between lightning-fast Astro templates or an easy-to-manage WordPress site.

Get Started

Services we offer:

Web Development

  • SPAs and corporate sites
  • High-performance landing pages
  • Professional portfolios

Mobile Development

  • Mobile-adapted web apps
  • React Native apps

UI/UX Design & Prototyping

  • Figma/Canva interfaces
  • UX research and improvements
  • Web and mobile prototypes

Development Services

  • Custom software
  • Maintenance/optimization
  • Migrations and bug fixing

We build the site for you

Catalog

Explore our template catalog for E-commerce and Websites. Modern and optimized designs.

Tech Stack

The tools and technologies we use daily to build fast, robust, and beautiful solutions.

html5javascripttypescriptangularastronodedotjstailwindcsssassbootstrapmongodbfirebasemysqlcloudflarefigmavercelnetlifygitmarkdownphpwordpresshtml5javascripttypescriptangularastronodedotjstailwindcsssassbootstrapmongodbfirebasemysqlcloudflarefigmavercelnetlifygitmarkdownphpwordpress

Documentation & Version Control

We deliver usage guides, changelogs, and Git best practices to ensure continuity and frictionless collaboration within your team.

Support & Maintenance

The first month of support is free. Continuous monitoring, fixes, and improvements to keep your solution healthy and updated.

Are you an existing client needing support?

Support Plans

Business Decisions Based on Reliable Data

Advanced analytics and automated workflows to optimize your strategic decisions.

Schedule a consultation!

Smart Automation with n8n

Integrate your data and automate repetitive tasks with n8n to improve operational efficiency.

  • Integrate data sources
  • Automate repetitive tasks
  • Improve operational efficiency
  • Always updated data

Intuitive Visual Analytics

Interactive charts that simplify the interpretation of complex data.

Custom Metrics

Specific tracking of KPIs tailored to your business goals.

Segmented Reports

Detailed analysis by region, client, or behavior for informed decisions.

Real-Time Updates

Dynamic dashboards reflecting data updated instantly.

Our Workflow for your website

A clear, fast, and transparent process. This is how we build your web presence, step by step.

Kickoff & Contract

STEP 1

Day 1

  • Align objectives, scope, and deliverables.
  • Define pages, features, and deadlines.
  • Signed contract and upfront payment to start.

Template or Custom Design

STEP 2

Week 1

  • Choose an optimized template or custom design.
  • Quick references and wireframes.
  • Define navigation structure.

Branding & Visual Design

STEP 3

Weeks 2 & 3

  • Identity: colors, typography, and UI components.
  • Design key sections.
  • Responsive versions and feedback adjustments.

Content & QA

STEP 4

Week 4

  • Upload client texts, images, and assets.
  • Basic on-page SEO and performance optimization.
  • Multi-device testing and detail fixing.

Launch & Support

STEP 5

Final day (+ 30 days free support)

  • Deployment on domain/hosting, analytics, and backups.
  • Delivery of a brief manual.
  • Post-launch support included.

Performance and Stability

Eliminate bugs and improve your system

Detect bottlenecks, automate processes, and ensure every line of code is aligned with business goals.

Migrations and Bugs

Error Control

Avoid failures from poorly planned migrations or poorly defined requirements that cause silent errors.

Learn more →

Deprecated Libraries

Stay updated

Reduce vulnerabilities and conflicts by keeping your dependencies always up-to-date and well-audited.

Learn more →

Automation with n8n

Automate without limits

Connect services, fix recurring errors, and automate critical flows so nothing slips through the cracks.

Learn more →